A4gnt Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant A4gnt, Each

Details:

This gene encodes a protein from the glycosyltransferase 32 family. The enzyme catalyzes the transfer of n-acetylglucosamine (glcnac) to core 2 branched o-glycans. It forms a unique glycan, glcnacalpha1-->4galbeta-->r and is largely associated with the golgi apparatus membrane. [Provided by refseqsequence: nfvehynsaiwgnqgpelmtrmlrvwckledfqevsdlrclnisflhpqrfypisyrewrryyevwdtepsfnvsyalhlwnhmnqegravirgsntlvenlyrkhcprtyrdlikgpegsvtgelg