Web Analytics
518-831-8000 sales@utechproducts.com

Abca5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abca5, Each

$ 1,757.70

Details

The membrane-associated protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intracellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, and white). This encoded protein is a member of the abc1 subfamily. Members of the abc1 subfamily comprise the only major abc subfamily found exclusively in multicellular eukaryotes. This gene is clustered among 4 other abc1 family members on 17q24, but neither the substrate nor the function of this gene is known. Alternative splicing of this gene results in several transcript variants; however, not all variants have been fully described. [Provided by refseqsequence: pnkkyeevpnielnpmdkftlsnlilgytpvtnitssimqkvstdhlpdviiteeytnekemltsslskpsnfv

Additional Information

SKU 10287665
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21472