Abcb7 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abcb7, Each

Details:

The membrane-associated protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intra-cellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, white). This protein is a member of the mdr/tap subfamily. Members of the mdr/tap subfamily are involved in multidrug resistance as well as antigen presentation. This gene encodes a half-transporter involved in the transport of heme from the mitochondria to the cytosol. With iron/sulfur cluster precursors as its substrates, this protein may play a role in metal homeostasis. Mutations in this gene have been implicated in x-linked sideroblastic anemia with ataxia. [Provided by refseqsequence: gamkdvvkhrtsifiahrlstvvdadeiivldqgkvaergthhgllanphsiysemwhtqssrvqnhdnpkweakkeniskeeerkklqeei