Abcd4, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abcd4, Each

Details:

The protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intra-cellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, white). This protein is a member of the ald subfamily, which is involved in peroxisomal import of fatty acids and/or fatty acyl-coas in the organelle. All known peroxisomal abc transporters are half transporters which require a partner half transporter molecule to form a functional homodimeric or heterodimeric transporter. The function of this peroxisomal membrane protein is unknown. However, it is speculated that it may function as a heterodimer for another peroxisomal abc transporter and, therefore, may modify the adrenoleukodystrophy phenotype. It may also play a role in the process of peroxisome biogenesis. Alternative splicing results in at least two different transcript variants, one which is protein-coding and one which is probably not protein-coding. [Provided by refseqsequence: tlvsknafvciyliscftqlidlsttlsdvagythrigqlretlldmslksqdceilgesewgldtppgwpaaepadtafllervsisapssdkplikdlslkisegqsllitgntgtgk