Abcg5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abcg5, Each

Details:

The protein encoded by this gene is a member of the superfamily of atp-binding cassette (abc) transporters. Abc proteins transport various molecules across extra- and intra-cellular membranes. Abc genes are divided into seven distinct subfamilies (abc1, mdr/tap, mrp, ald, oabp, gcn20, white). This protein is a member of the white subfamily. The protein encoded by this gene functions as a half-transporter to limit intestinal absorption and promote biliary excretion of sterols. It is expressed in a tissue-specific manner in the liver, colon, and intestine. This gene is tandemly arrayed on chromosome 2, in a head-to-head orientation with family member abcg8. Mutations in this gene may contribute to sterol accumulation and atheroschlerosis, and have been observed in patients with sitosterolemia. [Provided by refseqsequence: ihqprselfqlfdkiailsfgelifcgtpaemldffndcgypcpehsnpfdfymdltsvdtqskereietskrvqmiesaykksaichktlkniermkhlktlpmvpfktkdspgvfsklgvll