Web Analytics
518-831-8000 sales@utechproducts.com

Abhd8 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Abhd8, Each

$ 1,757.70

Details

This gene is upstream of, and in a head-to-head orientation with the gene for the mitochondrial ribosomal protein l34. The predicted protein contains alpha/beta hydrolase fold and secretory lipase domains. [Provided by refseqsequence: rqgakekqllkegnafnvssfvlrammsgqywpegdevyhaeltvpvllvhgmhdkfvpveedqrmaeilllaflklidegshmvmlecpetv

Additional Information

SKU 10289104
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23144