Web Analytics
518-831-8000 sales@utechproducts.com

ABHD8 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ABHD8, Each

1,757.70

Details:

This gene is upstream of, and in a head-to-head orientation with the gene for the mitochondrial ribosomal protein L34. The predicted protein contains alpha/beta hydrolase fold and secretory lipase domains. [provided by RefSeqSequence: RQGAKEKQLLKEGNAFNVSSFVLRAMMSGQYWPEGDEVYHAELTVPVLLVHGMHDKFVPVEEDQRMAEILLLAFLKLIDEGSHMVMLECPETV

Additional Information

SKU 10289104
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23144