Web Analytics
518-831-8000 sales@utechproducts.com

Ace Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ace, Each

$ 1,433.70

Details

This gene encodes an enzyme involved in catalyzing the conversion of angiotensin i into a physiologically active peptide angiotensin ii. Angiotensin ii is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287bp alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Two most abundant alternatively spliced variants of this gene encode two isozymes - the somatic form and the testicular form that are equally active. Multiple additional alternatively spliced variants have been identified but their full length nature has not been determined. [Provided by refseqsequence: kfveeydrtsqvvwneyaeanwnyntnittetskillqknmqianhtlkygtqarkfdvnqlqnttikriikkvqdleraalpaqeleeynkilldmettysvatvchpngsclqlepdltnvmatsrkyedllwawe

Additional Information

SKU 10291891
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27843