Web Analytics
518-831-8000 sales@utechproducts.com

Acly Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Acly, Each

1,757.70

Details:

Atp citrate lyase is the primary enzyme responsible for the synthesis of cytosolic acetyl-coa in many tissues. The enzyme is a tetramer (relative molecular weight approximately 440,000) of apparently identical subunits. It catalyzes the formation of acetyl-coa and oxaloacetate from citrate and coa with a concomitant hydrolysis of atp to adp and phosphate. The product, acetyl-coa, serves several important biosynthetic pathways, including lipogenesis and cholesterogenesis. In nervous tissue, atp citrate-lyase may be involved in the biosynthesis of acetylcholine. Two transcript variants encoding distinct isoforms have been identified for this gene. [Provided by refseqsequence: aeefyvciyatregdyvlfhheggvdvgdvdakaqkllvgvdeklnpedikkhllvhapedkkeilasfisglfnfyedlyftyleinplvvtkdgv

Additional Information

SKU 10287685
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21495