Web Analytics
518-831-8000 sales@utechproducts.com

ADAMTS10, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ADAMTS10, Each

1,757.70

Details:

This gene belongs to the ADAMTS (a disintegrin and metalloproteinase domain with thrombospondin type-1 motifs) family of zinc-dependent proteases. ADAMTS proteases are complex secreted enzymes containing a prometalloprotease domain of the reprolysin type attached to an ancillary domain with a highly conserved structure that includes at least one thrombospondin type 1 repeat. They have been demonstrated to have important roles in connective tissue organization, coagulation, inflammation, arthritis, angiogenesis and cell migration. The product of this gene plays a major role in growth and in skin, lens, and heart development. It is also a candidate gene for autosomal recessive Weill-Marchesani syndrome. [provided by RefSeqSequence: SLIVMVLARTELPALRYRFNAPIARDSLPPYSWHYAPWTKCSAQCAGGSQVQAVECRNQLDSSAVAPHYCSAHSKLPK

Additional Information

SKU 10289537
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23637