Web Analytics
518-831-8000 sales@utechproducts.com

ADPRHL2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ADPRHL2, Each

1,757.70

Details:

This gene encodes a member of the ADP-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of ADP-ribose from ADP-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasmSequence: VGSFYEAHDTVDLTSVLRHVQSLEPDPGTPGSERTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDRGYGAGVV

Additional Information

SKU 10288027
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21875