Web Analytics
518-831-8000 sales@utechproducts.com

Adprhl2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Adprhl2, Each

1,757.70

Details

This gene encodes a member of the adp-ribosylglycohydrolase family. The encoded enzyme catalyzes the removal of adp-ribose from adp-ribosylated proteins. This enzyme localizes to the mitochondria, in addition to the nucleus and cytoplasmsequence: vgsfyeahdtvdltsvlrhvqslepdpgtpgsertealyytddtamaralvqsllakeafdevdmahrfaqeykkdpdrgygagvv

Additional Information

SKU 10288027
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21875