Adrbk2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Adrbk2, Each
$ 1,750.95
|
|
Details:
The beta-adrenergic receptor kinase specifically phosphorylates the agonist-occupied form of the beta-adrenergic and related g protein-coupled receptors. Overall, the beta adrenergic receptor kinase 2 has 85% amino acid similarity with beta adrenergic receptor kinase 1, with the protein kinase catalytic domain having 95% similarity. These data suggest the existence of a family of receptor kinases which may serve broadly to regulate receptor function. [Provided by refseqsequence: yeavnadtdkiearkraknkqlgheedyalgkdcimhgymlklgnpfltqwqrryfylfpnrlewrgegesrqnlltmeqilsveetqikdkkcilfrikggkqfvlqcesdpefvqwkkelnetfkeaqrllrrapkflnkprs
Additional Information
| SKU | 10286375 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB19998 |
