Web Analytics
518-831-8000 sales@utechproducts.com

Agxt2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Agxt2, Each

1,757.70

Details

The protein encoded by this gene is a class iii pyridoxal-phosphate-dependent mitochondrial aminotransferase. It catalyzes the conversion of glyoxylate to glycine using l-alanine as the amino donor. [Provided by refseqsequence: dvrgkglmigiemvqdkiscrplpreevnqihedckhmgllvgrgsifsqtfriapsmcitkpevdfavevfrsaltqhmerrak

Additional Information

SKU 10289066
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23103