Web Analytics
518-831-8000 sales@utechproducts.com

ALAS2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ALAS2, Each

1,757.70

Details:

The product of this gene specifies an erythroid-specific mitochondrially located enzyme. The encoded protein catalyzes the first step in the heme biosynthetic pathway. Defects in this gene cause X-linked pyridoxine-responsive sideroblastic anemia. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: GNYVFSYDQFFRDKIMEKKQDHTYRVFKTVNRWADAYPFAQHFSEASVASKDVSVWCSNDYLGMSRHPQVLQATQETLQRHGAGAGGTRNISGTSKFHVELEQELAELHQKDSALLFSSCFVANDSTLFTLAKILPGCEIYSDAGNHAS

Additional Information

SKU 10292349
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28468