Web Analytics
518-831-8000 sales@utechproducts.com

ALDH1A2, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ALDH1A2, Each

1,757.70

Details:

This protein belongs to the aldehyde dehydrogenase family of proteins. The product of this gene is an enzyme that catalyzes the synthesis of retinoic acid (RA) from retinaldehyde. Retinoic acid, the active derivative of vitamin A (retinol), is a hormonal signaling molecule that functions in developing and adult tissues. The studies of a similar mouse gene suggest that this enzyme and the cytochrome CYP26A1, concurrently establish local embryonic retinoic acid levels which facilitate posterior organ development and prevent spina bifida. Three transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeqSequence: VVGSPFDPTTEQGPQIDKKQYNKILELIQSGVAEGAKLECGGKGLGRKGFFIEPTVFSNVTDDMRIAKEEIFGPVQEILRFKTMDEVIERANNSDFGLVAAVFTNDINKALTVSSAMQAGTV

Additional Information

SKU 10286816
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20491