Web Analytics
518-831-8000 sales@utechproducts.com

ALDH1A3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ALDH1A3, Each

1,757.70

Details:

Aldehyde dehydrogenase isozymes are thought to play a major role in the detoxification of aldehydes generated by alcohol metabolism and lipid peroxidation. The enzyme encoded by this gene uses retinal as a substrate, either in a free or cellular retinol-binding protein form. [provided by RefSeqSequence: ERGGAMATANGAVENGQPDRKPPALPRPIRNLEVKFTKIFIN

Additional Information

SKU 10290160
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24490