Web Analytics
518-831-8000 sales@utechproducts.com

Alg3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Alg3, Each

1,757.70

Details

This gene encodes a member of the alg3 family. The encoded protein catalyses the addition of the first dol-p-man derived mannose in an alpha 1,3 linkage to man5glcnac2-pp-dol. Defects in this gene have been associated with congenital disorder of glycosylation type id (cdg-id) characterized by abnormal n-glycosylation. Multiple transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: idwkaymaevegvingtydytqlqgdtgplvypagfvyifmglyyatsrgtdir

Additional Information

SKU 10290067
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24386