Web Analytics
518-831-8000 sales@utechproducts.com

ALMS1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ALMS1, Each

1,757.70

Details:

This gene encodes a protein containing a large tandem-repeat domain. The mouse ortholog of this gene has been shown to function in ciliogenesis in inner medullary collecting duct cells. Mutations in this gene have been associated with Alstrom syndrome. Alternative splice variants have been described but their full length sequences have not been determinedSequence: DFFQHHPDKHREHMCLPLPYQNMDKTKTDYTRIKSLSINVNLGNKEVMDTTKSQVRDYPKHNGQISDPQRDQKVTP

Additional Information

SKU 10289879
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24022