Web Analytics
518-831-8000 sales@utechproducts.com

Ankhd1-Eif4ebp3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ankhd1-Eif4ebp3, Each

1,757.70

Details

The ankhd1-eif4ebp3 mrna is an infrequent but naturally occurring co-transcribed product of the neighboring ankhd1 and eif4ebp3 genes. This fusion transcript encodes a protein composed mostly of the multiple ankyrin repeats, single kh-domain protein, with its c-terminus encoded in a different reading frame from the shared portion of the eif4ebp3 gene. The significance of this co-transcribed mrna and the function of its protein product have not yet been determined. [Provided by refseqsequence: qkverqlqmktqqqftkeyletkgqkdtvslhqqcshrgvfpegegdgslpedhfselpqvdtilfkdndvddeqqsppsaeqidfvpvqplsspqcnfssdlgsngtnslelqkvsgnqqivgqpqiaitghdqgllvqepd

Additional Information

SKU 10291692
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27464