Web Analytics
518-831-8000 sales@utechproducts.com

ANKHD1-EIF4EBP3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ANKHD1-EIF4EBP3, Each

1,757.70

Details:

The ANKHD1-EIF4EBP3 mRNA is an infrequent but naturally occurring co-transcribed product of the neighboring ANKHD1 and EIF4EBP3 genes. This fusion transcript encodes a protein composed mostly of the multiple ankyrin repeats, single KH-domain protein, with its C-terminus encoded in a different reading frame from the shared portion of the EIF4EBP3 gene. The significance of this co-transcribed mRNA and the function of its protein product have not yet been determined. [provided by RefSeqSequence: QKVERQLQMKTQQQFTKEYLETKGQKDTVSLHQQCSHRGVFPEGEGDGSLPEDHFSELPQVDTILFKDNDVDDEQQSPPSAEQIDFVPVQPLSSPQCNFSSDLGSNGTNSLELQKVSGNQQIVGQPQIAITGHDQGLLVQEPD

Additional Information

SKU 10291692
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27464