Web Analytics
518-831-8000 sales@utechproducts.com

Ankk1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ankk1, Each

$ 1,757.70

Details

The protein encoded by this gene belongs to the ser/thr protein kinase family, and protein kinase superfamily involved in signal transduction pathways. This gene is closely linked to drd2 gene (geneid:1813) on chr 11, and a well studied restriction fragment length polymorphism (rflp) designated taqia, was originally associated with the drd2 gene, however, later was determined to be located in exon 8 of ankk1 gene (pmids: 18621654, 15146457), where it causes a nonconservative amino acid substitution. It is not clear if this gene plays any role in neuropsychiatric disorders previously associated with taq1a rflp. [Provided by refseqsequence: evnedisqelmdsdsgnylkralqlsdrknlvprdeelciyenkvtplhflvaqgsveqvrlllahevdvdcqtasgytplliaaqdqqpdlcalllahgadanrvdedgwaplhfaaqngddgtarllldhgacvdaqer

Additional Information

SKU 10286934
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20626