Web Analytics
518-831-8000 sales@utechproducts.com

ANKRD2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ANKRD2, Each

1,757.70

Details:

ANKRD2 belongs to the conserved muscle ankyrin repeat protein (MARP) family. Expression of MARPs is induced in response to physiologic stress, injury, and hypertrophy (Miller et al., 2003 [PubMed 14583192]).[supplied by OMIMSequence: EEENEKLRGDARQKLPMDLLVLEDEKHHGAQSAALQKVKGQERVRKTSLDLRREIIDVGGIQNLIELRKKRKQKKRD

Additional Information

SKU 10291929
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27885