Web Analytics
518-831-8000 sales@utechproducts.com

ANKRD23, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ANKRD23, Each

1,757.70

Details:

This gene is a member of the muscle ankyrin repeat protein (MARP) family and encodes a protein with four tandem ankyrin-like repeats. The protein is localized to the nucleus, functioning as a transcriptional regulator. Expression of this protein is induced during recovery following starvation. [provided by RefSeqSequence: KRLRHRVPPRKPEPLVKPQSQAQVEPVGLEMFLKAAAENQEYLIDKYLTDGGDPNAHDKLHRTALHWAC

Additional Information

SKU 10288953
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22965