Web Analytics
518-831-8000 sales@utechproducts.com

Aox1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Aox1, Each

1,757.70

Details:

Aldehyde oxidase produces hydrogen peroxide and, under certain conditions, can catalyze the formation of superoxide. Aldehyde oxidase is a candidate gene for amyotrophic lateral sclerosis. [Provided by refseqsequence: myhallkhlgtlagsqirnmaslgghiisrhpdsdlnpilavgnctlnllskegkrqiplneqflskcpnadlkpqeilvsvnipysrkwe

Additional Information

SKU 10289534
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23634