Web Analytics
518-831-8000 sales@utechproducts.com

Ap3b2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ap3b2, Each

$ 1,757.70

Details

Adaptor protein-3 (ap3) is a heterotetrameric vesicle-coat protein complex. Some ap3 subunits are ubiquitously expressed, whereas others are expressed exclusively in neurons. The neuron-specific ap3 complex, which includes ap3b2, is thought to serve neuron-specific functions such as neurotransmitter release (grabner et al., 2006 [Pubmed 16788073]).[Supplied by omimsequence: apvfmsenefkkeqgklmgmneiteklmlpdtcrsdhivvqkvtatanlgrvpcgtsdeyrfagrtltggslvlltldarpagaaqltvnsekmvigtmlvkdviq

Additional Information

SKU 10289455
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23545