Web Analytics
518-831-8000 sales@utechproducts.com

AP4S1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AP4S1, Each

1,757.70

Details:

The heterotetrameric adaptor protein (AP) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. AP4 is composed of 2 large chains, beta-4 (AP4B1; MIM 607245) and epsilon-4 (AP4E1; MIM 607244), a medium chain, mu-4 (AP4M1; MIM 602296), and a small chain, sigma-4 (AP4S1).[supplied by OMIMSequence: LDEYFSRVSELDVSFFNTVFHSTWQMHSGPYQEPIDELPKICSALEPQQTCFSPDSSSFKGAASTT

Additional Information

SKU 10289506
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23605