Web Analytics
518-831-8000 sales@utechproducts.com

Ap4s1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ap4s1, Each

$ 1,757.70

Details

The heterotetrameric adaptor protein (ap) complexes sort integral membrane proteins at various stages of the endocytic and secretory pathways. Ap4 is composed of 2 large chains, beta-4 (ap4b1; mim 607245) and epsilon-4 (ap4e1; mim 607244), a medium chain, mu-4 (ap4m1; mim 602296), and a small chain, sigma-4 (ap4s1).[Supplied by omimsequence: ldeyfsrvseldvsffntvfhstwqmhsgpyqepidelpkicsalepqqtcfspdsssfkgaastt

Additional Information

SKU 10289506
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23605