Web Analytics
518-831-8000 sales@utechproducts.com

Apoa4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Apoa4, Each

$ 1,757.70

Details

Apoliprotein (apo) a-iv gene contains 3 exons separated by two introns. A sequence polymorphism has been identified in the 3'utr of the third exon. The primary translation product is a 396-residue preprotein which after proteolytic processing is secreted its primary site of synthesis, the intestine, in association with chylomicron particles. Although its precise function is not known, apo a-iv is a potent activator of lecithin-cholesterol acyltransferase in vitro. [Provided by refseqsequence: legltfqmkknaeelkarisasaeelrqrlaplaedvrgnlrgnteglqkslaelgghldqqveefrrrvepygenfnkalvqqmeqlrqklgphagdveghlsflekdlrdkvnsffstfkekesqdktlslp

Additional Information

SKU 10292302
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28418