Web Analytics
518-831-8000 sales@utechproducts.com

APOH, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant APOH, Each

1,757.70

Details:

Apolipoprotein H has been implicated in a variety of physiologic pathways including lipoprotein metabolism, coagulation, and the production of antiphospholipid autoantibodies. APOH may be a required cofactor for anionic phospholipid binding by the antiphospholipid autoantibodies found in sera of many patients with lupus and primary antiphospholipid syndrome, but it does not seem to be required for the reactivity of antiphospholipid autoantibodies associated with infections. [provided by RefSeqSequence: ECREVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFSKTDASDVK

Additional Information

SKU 10292354
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28473