Web Analytics
518-831-8000 sales@utechproducts.com

Apol5, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Apol5, Each

1,757.70

Details

This gene is a member of the apolipoprotein l gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. [Provided by refseqsequence: aitnivtnvlenrsnsaardkasrlgplttsheafgginwseieaagfcvnkcvkaiqgikdlhayqmaksnsgfmamvknfv

Additional Information

SKU 10291934
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27891