Web Analytics
518-831-8000 sales@utechproducts.com

APOL5, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant APOL5, Each

1,757.70

Details:

This gene is a member of the apolipoprotein L gene family. The encoded protein is found in the cytoplasm, where it may affect the movement of lipids or allow the binding of lipids to organelles. [provided by RefSeqSequence: AITNIVTNVLENRSNSAARDKASRLGPLTTSHEAFGGINWSEIEAAGFCVNKCVKAIQGIKDLHAYQMAKSNSGFMAMVKNFV

Additional Information

SKU 10291934
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB27891