Web Analytics
518-831-8000 sales@utechproducts.com

APOO, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant APOO, Each

1,757.70

Details:

This gene is a member of the apolipoprotein family. Members of this protein family are involved in the transport and metabolism of lipids. The encoded protein associates with HDL, LDL and VLDL lipoproteins and is characterized by chondroitin-sulfate glycosylation. This protein may be involved in preventing lipid accumulation in the myocardium in obese and diabetic patients. Alternative splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 4, 5, 12 and 16Sequence: IKKLVYPPGFMGLAASLYYPQQAIVFAQVSGERLYDWGLRGYIVIEDLWKENFQKPGNVKNSPGTK

Additional Information

SKU 10286538
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20174