Web Analytics
518-831-8000 sales@utechproducts.com

AQP6, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant AQP6, Each

1,757.70

Details:

The protein encoded by this gene is an aquaporin protein, which functions as a water channel in cells. Aquaporins are a family of small integral membrane proteins related to the major intrinsic protein (MIP or AQP0). This protein is specific for the kidney. This gene and related family members AQP0, AQP2, and AQP5 reside in a cluster on chromosome 12q13. [provided by RefSeqSequence: PDTKTLAQRLAILTGTVEVGTGAGAGAEPLKKESQPGSGAVEME

Additional Information

SKU 10288080
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21937