Web Analytics
518-831-8000 sales@utechproducts.com

ARFGEF2 Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARFGEF2, Each

1,757.70

Details:

ADP-ribosylation factors (ARFs) play an important role in intracellular vesicular trafficking. The protein encoded by this gene is involved in the activation of ARFs by accelerating replacement of bound GDP with GTP and is involved in Golgi transport. It contains a Sec7 domain, which may be responsible for its guanine-nucleotide exchange activity and also brefeldin A inhibition. [provided by RefSeqSequence: KPIQSKPQSPVIQAAAVSPKFVRLKHSQAQSKPTTPEKTDLTNGEHARSDSGKVSTENGDAPRERGSSLSGTDDGAQEVVKDILEDVVTSAIKAAEKHGLTEPERVLGELECQECAIPPGVDENSQTNGI

Additional Information

SKU 10287957
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21791