Arhgap19, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgap19, Each

Details:

Members of the arhgap family, such as arhgap19, encode negative regulators of rho gtpases (see rhoa; mim 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and g1 cell cycle progression (lv et al., 2007 [Pubmed 17454002]).[Supplied by omimsequence: llthkhfnahlkiadlmqfddkgnktnipdkdrqiealqllflilpppnrnllkllldllyqtakkqdknkmsaynlalmf