Web Analytics
518-831-8000 sales@utechproducts.com

ARHGAP19, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARHGAP19, Each

1,757.70

Details:

Members of the ARHGAP family, such as ARHGAP19, encode negative regulators of Rho GTPases (see RHOA; MIM 165390), which are involved in cell migration, proliferation, and differentiation, actin remodeling, and G1 cell cycle progression (Lv et al., 2007 [PubMed 17454002]).[supplied by OMIMSequence: LLTHKHFNAHLKIADLMQFDDKGNKTNIPDKDRQIEALQLLFLILPPPNRNLLKLLLDLLYQTAKKQDKNKMSAYNLALMF

Additional Information

SKU 10289880
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24023