Arhgap23, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgap23, Each

Details:

The rho (see arha; mim 165390) family of small gtpases are involved in signal transduction through transmembrane receptors, and they are inactive in the gdp-bound form and active in the gtp-bound form. Gtpase-activating proteins, such as arhgap23, inactivate rho family proteins by stimulating their hydrolysis of gtp (katoh and katoh, 2004 [pubmed 15254754]).[Supplied by omimsequence: mnlgfgdespepeasgrgerlgrkvaplattedslasipfideptspsidlqakhvpasavvssamnsapvlgtspss