Web Analytics
518-831-8000 sales@utechproducts.com

ARHGAP23, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARHGAP23, Each

1,757.70

Details:

The RHO (see ARHA; MIM 165390) family of small GTPases are involved in signal transduction through transmembrane receptors, and they are inactive in the GDP-bound form and active in the GTP-bound form. GTPase-activating proteins, such as ARHGAP23, inactivate RHO family proteins by stimulating their hydrolysis of GTP (Katoh and Katoh, 2004 [PubMed 15254754]).[supplied by OMIMSequence: MNLGFGDESPEPEASGRGERLGRKVAPLATTEDSLASIPFIDEPTSPSIDLQAKHVPASAVVSSAMNSAPVLGTSPSS

Additional Information

SKU 10287466
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21244