Arhgef10l Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arhgef10l, Each
$ 1,757.70
|
|
Details:
Arhgef10l is a member of the rhogef family of guanine nucleotide exchange factors (gefs) that activate rho gtpases (winkler et al., 2005 [Pubmed 16112081]).[Supplied by omimsequence: atvhpticlglqdgsillyssvdtgtqclvscrspglqpvlclrhspfhllaglqdgtlaayprtsggvlwdlesppvcltvgpgpvrtllsledavwas
Additional Information
| SKU | 10288111 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21973 |
