Web Analytics
518-831-8000 sales@utechproducts.com

ARHGEF18, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARHGEF18, Each

1,757.70

Details:

Rho GTPases are GTP binding proteins that regulate a wide spectrum of cellular functions. These cellular processes include cytoskeletal rearrangements, gene transcription, cell growth and motility. Activation of Rho GTPases is under the direct control of guanine nucleotide exchange factors (GEFs). The protein encoded by this gene is a guanine nucleotide exchange factor and belongs to the Rho GTPase GFE family. Family members share a common feature, a Dbl (DH) homology domain followed by a pleckstrin (PH) homology domain. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: RYPTHFLSTNSVLASVTASLKEHPRGTLLSDGSPALSRNVGMTVSQKGGPQPTPSPAGPGTQLGPITGEMDEADSAFLKFKQTADDSLSLTSPNTESI

Additional Information

SKU 10289837
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB23969