Web Analytics
518-831-8000 sales@utechproducts.com

Arl4c, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Arl4c, Each

1,757.70

Details

Adp-ribosylation factor-like 4c is a member of the adp-ribosylation factor family of gtp-binding proteins. Arl4c is closely similar to arl4a and arl4d and each has a nuclear localization signal and an unusually high guanine nucleotide exchange rate. This protein may play a role in cholesterol transport. [Provided by refseqsequence: giiyvvdsvdvdrleeaktelhkvtkfaenqgtpllviankqdlpkslpvaeiekqlalhelipattyhvqpacaiigegltegmdklyemilkrrkslkqkkkr

Additional Information

SKU 10288323
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22227