Web Analytics
518-831-8000 sales@utechproducts.com

ARSD, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ARSD, Each

1,757.70

Details:

The protein encoded by this gene is a member of the sulfatase family. Sulfatases are essential for the correct composition of bone and cartilage matrix. This encoded protein is postranslationally glycosylated and localized to the lysosome. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: QGAEARSAHEFLFHYCGQHLHAARWHQKDSGSVWKVHYTTPQFHPEGAGACYGRGVCPCSGEGVTHHRPPLLFDLSRDPSEARPLTPDSEPLYHAVIARVGAAVSEHRQTLSPVPQQFSMSNILWKPWLQPCCGHFPFCSCHED

Additional Information

SKU 10286628
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20273