Ascl3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ascl3, Each
$ 1,757.70
|
|
Details:
Basic helix-loop-helix transcription factors, such as ascl3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (jonsson et al., 2004 [Pubmed 15475265]).[Supplied by omimsequence: nsslpdklpifpdsarlpltrsfylepmvtfhvhpeapvsspyseelprlpfpsdslilgnysepcpfsfpmpypnyrgceysygp
Additional Information
| SKU | 10288129 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB21997 |
Loading Cart Data 