Web Analytics
518-831-8000 sales@utechproducts.com

Ascl3, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Ascl3, Each

$ 1,757.70

Details

Basic helix-loop-helix transcription factors, such as ascl3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (jonsson et al., 2004 [Pubmed 15475265]).[Supplied by omimsequence: nsslpdklpifpdsarlpltrsfylepmvtfhvhpeapvsspyseelprlpfpsdslilgnysepcpfsfpmpypnyrgceysygp

Additional Information

SKU 10288129
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21997