Web Analytics
518-831-8000 sales@utechproducts.com

ASCL3, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ASCL3, Each

1,757.70

Details:

Basic helix-loop-helix transcription factors, such as ASCL3, are essential for the determination of cell fate and the development and differentiation of numerous tissues (Jonsson et al., 2004 [PubMed 15475265]).[supplied by OMIMSequence: NSSLPDKLPIFPDSARLPLTRSFYLEPMVTFHVHPEAPVSSPYSEELPRLPFPSDSLILGNYSEPCPFSFPMPYPNYRGCEYSYGP

Additional Information

SKU 10288129
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21997