Asgr1 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Asgr1, Each

Details:

Partially deglycosylated plasma glycoproteins and immunoglobulin iga2 allotypes are efficiently and specifically removed from circulation by a receptor-mediated process. The asialoglycoprotein receptor binds to desialylated (galactosyl-terminal) glycoproteins. It transports these glycoproteins via a series of membrane vesicles and tubules to an acidic-sorting organelle where the receptor and ligand dissociate. Then the receptor is recycled back to the cell surface and the ligand is transported to the lysosomes for degradation. [Provided by refseqsequence: mtkeyqdlqhldneesdhhqlrkgppppqpllqrlcsgprl