Web Analytics
518-831-8000 sales@utechproducts.com

ATP11A Rabbit anti-Human, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ATP11A, Each

1,757.70

Details:

The protein encoded by this gene is an integral membrane ATPase. The encoded protein is probably phosphorylated in its intermediate state and likely drives the transport of ions such as calcium across membranes. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeqSequence: SATGEIYLFCKGADSSIFPRVIEGKVDQIRARVERNAVEGLRTLCVAYKRLIQEEYEGICKLLQAAKVALQDREKKLAEAYEQIEKDLTLLG

Additional Information

SKU 10288887
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB22885