Web Analytics
518-831-8000 sales@utechproducts.com

ATP1B1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ATP1B1, Each

1,757.70

Details:

The protein encoded by this gene belongs to the family of Na /K and H /K ATPases beta chain proteins, and to the subfamily of Na /K -ATPases. Na /K -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na /K -ATPase is encoded by multiple genes. This gene encodes a beta 1 subunit. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeqSequence: SEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPN

Additional Information

SKU 10286944
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20637