Atp4a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Atp4a, Each

Details:

The protein encoded by this gene belongs to a family of p-type cation-transporting atpases. The gastric h , k -atpase is a heterodimer consisting of a high molecular weight catalytic alpha subunit and a smaller but heavily glycosylated beta subunit. This enzyme is a proton pump that catalyzes the hydrolysis of atp coupled with the exchange of h( ) and k( ) ions across the plasma membrane. It is also responsible for gastric acid secretion. This gene encodes a catalytic alpha subunit of the gastric h , k -atpase. [Provided by refseqsequence: tdyftamaqegwfpllcvglraqwedhhlqdlqdsygq