Web Analytics
518-831-8000 sales@utechproducts.com

Atp6v0a4 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Atp6v0a4, Each

$ 1,757.70

Details

This gene encodes a component of vacuolar atpase (v-atpase), a multisubunit enzyme that mediates acidification of intracellular compartments of eukaryotic cells. V-atpase dependent acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-atpase is composed of a cytosolic v1 domain and a transmembrane v0 domain. The v1 domain consists of three a and three b subunits, two g subunits plus the c, d, e, f, and h subunits. The v1 domain contains the atp catalytic site. The v0 domain consists of five different subunits: a, c, c', c'', and d. This gene is one of four genes in man and mouse that encode different isoforms of the a subunit. Alternatively spliced transcript variants encoding the same protein have been described. Mutations in this gene are associated with renal tubular acidosis associated with preserved hearing. [Provided by refseqsequence: rashrksqlqasriqedateniegdssspssrsgqrtsadthgalddhgeefnfgdvfvhqaihtieyclgcisntas

Additional Information

SKU 10287247
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21000