Web Analytics
518-831-8000 sales@utechproducts.com

ATP7A, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant ATP7A, Each

1,757.70

Details:

This gene encodes a transmembrane protein that functions in copper transport across membranes. The protein localizes to the trans-Golgi network, where it is predicted to supply copper to copper-dependent enzymes in the secretory pathway. The protein relocalizes to the plasma membrane under conditions of elevated extracellular copper and functions in the efflux of copper from cells. Mutations in this gene result in Menkes disease, X-linked cutis laxa, and occipital horn syndrome. [provided by RefSeqSequence: TETLGTCIDFQVVPGCGISCKVTNIEGLLHKNNWNIEDNNIKNASLVQIDASNEQSSTSSSMIIDAQISNALNAQQYKVLIGNREWMIRNGLVINNDVNDFMTEHERKGRTAVLVAVDDELC

Additional Information

SKU 10286940
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB20632