B3gat2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant B3gat2, Each

Details:

The product of this gene is a transmembrane protein belonging to the glucuronyltransferase family, and catalyzes the transfer of a beta-1,3 linked glucuronic acid to a terminal galactose in different glycoproteins or glycolipids containing a gal-beta-1-4glcnac or gal-beta-1-3glcnac residue. The encoded protein is involved in the synthesis of the human natural killer-1 (hnk-1) carbohydrate epitope, a sulfated trisaccharide implicated in cellular migration and adhesion in the nervous system. [Provided by refseqsequence: pvglvggrryerplvengkvvgwytgwradrpfaidmagfavslqvilsnpkavfkrrgsqpgmqesdflkqittveelepkannctkvlvwhtrtekvnlanepkyhldtvk