Bank1, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bank1, Each
$ 1,757.70
|
|
Details:
Bank1 is a b-cell-specific scaffold protein and lyn (mim 165120) tyrosine kinase substrate that promotes tyrosine phosphorylation of inositol 1,4,5-trisphosphate receptors (see itpr1; mim 147265) (yokoyama et al., 2002 [Pubmed 11782428]).[Supplied by omimsequence: rhghkelkkifedfsiqeidinneqendyeediasfstyipstqnpafhhesrktygqsadgaeanemegegkqngsgmetkhspl
Additional Information
| SKU | 10289060 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23096 |
