Web Analytics
518-831-8000 sales@utechproducts.com

BCHE, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BCHE, Each

1,757.70

Details:

Mutant alleles at the BCHE locus are responsible for suxamethonium sensitivity. Homozygous persons sustain prolonged apnea after administration of the muscle relaxant suxamethonium in connection with surgical anesthesia. The activity of pseudocholinesterase in the serum is low and its substrate behavior is atypical. In the absence of the relaxant, the homozygote is at no known disadvantage. [provided by RefSeqSequence: QQLALQWVQKNIAAFGGNPKSVTLFGESAGAASVSLHLLSPGSHSLFTRAILQSGSFNAPWAVTSLYEARNRTLNLAKLTGCSRENETEIIKCLRNKDPQEILLNEAFVVPYGTPLSVNFGPTVD

Additional Information

SKU 10292331
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28449