Web Analytics
518-831-8000 sales@utechproducts.com

Bcl7a, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bcl7a, Each

1,757.70

Details

This gene is directly involved, with myc and igh, in a three-way gene translocation in a burkitt lymphoma cell line. As a result of the gene translocation, the n-terminal region of the gene product is disrupted, which is thought to be related to the pathogenesis of a subset of high-grade b cell non-hodgkin lymphoma. The n-terminal segment involved in the translocation includes the region that shares a strong sequence similarity with those of bcl7b and bcl7c. Two transcript variants encoding different isoforms have been found for this gene. [Provided by refseqsequence: qadgkehpgaedasdeqnsqssmehsmnssekvdrqpsgdsglaaetsaisqdlegvppskkmkleasqqnse

Additional Information

SKU 10292014
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB28020