Bfsp2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bfsp2, Each

Details:

More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (bf). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and dowling-meara epidermolysis bullosa simplex. [Provided by refseqsequence: lsrnyeedvkllhkqlagceleqmdapigtglddiletiriqwerdveknrveagallqakqqaevahmsqtqeeklaaalrve