Bfsp2, Rabbit, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bfsp2, Each
$ 1,757.70
|
|
Details:
More than 99% of the vertebrate ocular lens is comprised of terminally differentiated lens fiber cells. Two lens-specific intermediate filament-like proteins, the protein product of this gene (phakinin), and filensin, are expressed only after fiber cell differentiation has begun. Both proteins are found in a structurally unique cytoskeletal element that is referred to as the beaded filament (bf). Mutations in this gene have been associated with juvenile-onset, progressive cataracts and dowling-meara epidermolysis bullosa simplex. [Provided by refseqsequence: lsrnyeedvkllhkqlagceleqmdapigtglddiletiriqwerdveknrveagallqakqqaevahmsqtqeeklaaalrve
Additional Information
| SKU | 10289229 |
|---|---|
| UOM | Each |
| UNSPSC | 12352203 |
| Manufacturer Part Number | PAB23290 |
