Web Analytics
518-831-8000 sales@utechproducts.com

BICC1, Rabbit, Polyclonal Antibody, Abnova, Rabbit polyclonal antibody raised against recombinant BICC1, Each

1,757.70

Details:

This gene encodes an RNA-binding protein that is active in regulating gene expression by modulating protein translation during embryonic development. Mouse studies identified the corresponding protein to be under strict control during cell differentiation and to be a maternally provided gene product. [provided by RefSeqSequence: NAGDLKQMMCPSKVSCAKRQTVELLQGTKNSHLHSTDRLLSDPELSATESPLADKKAPGSERAAERAAAAQQNSERAHLAPRSSYVNMQAFDYEQKKLLATKAMLKKPVVTEVRTPTNTWSGLGFSKSMPAETIKELRRA

Additional Information

SKU 10290074
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB24394