Web Analytics
518-831-8000 sales@utechproducts.com

Bicd2 Rabbit Anti-Human, Polyclonal Antibody, Abnova, Rabbit Polyclonal Antibody Raised Against Recombinant Bicd2, Each

1,757.70

Details

This gene is one of two human homologs of drosophila bicaudal-d and a member of the bicoid family. It has been implicated in dynein-mediated, minus end-directed motility along microtubules. It has also been reported to be a phosphorylation target of nima related kinase 8. Two alternative splice variants have been described. [Provided by refseqsequence: msapseeeeyarlvmeaqpewlraevkrlshelaettrekiqaaeyglavleekhqlklqfeelevdyeai

Additional Information

SKU 10287709
UOM Each
UNSPSC 12352203
Manufacturer Part Number PAB21522